MRPL55 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MRPL55 Polyclonal antibody, PBS Only (17679-1-PBS)

• 

  WB analysis of HEK-293 using 17679-1-AP (same clone as 17679-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17679-1-AP (MRPL55 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17679-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 17679-1-AP (same clone as 17679-1-PBS)

  IP result of anti-MRPL55 (IP:17679-1-AP, 4ug; Detection:17679-1-AP 1:600) with HEK-293 cells lysate 1680 ug. This data was developed using the same antibody clone with 17679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 17679-1-AP (same clone as 17679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17679-1-AP (MRPL55 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 17679-1-AP (same clone as 17679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17679-1-AP (MRPL55 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 17679-1-AP (same clone as 17679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 17679-1-AP (MRPL55 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 17679-1-AP (same clone as 17679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 17679-1-AP (MRPL55 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17679-1-PBS in a different storage buffer formulation.

MRPL55 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 17679-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

MRP L55, Mitochondrial large ribosomal subunit protein bL31m, Large ribosomal subunit protein mL55, L55nt, L55mt

---

Product Information

17679-1-PBS targets MRPL55 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11716

  Product name: Recombinant human MRPL55 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-128 aa of BC052806

  Sequence: MAAVGSLLGRLRQSTVKATGPALRRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK

• Full Name: mitochondrial ribosomal protein L55
• Calculated Molecular Weight: 128 aa, 15 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC052806
• Gene Symbol: MRPL55
• Gene ID (NCBI): 128308
• RRID: AB_2878427
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z7F7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MRPL55, also named as L55mt and MRP-L55, is a component of the mitochondrial ribosome large subunit (39S). It acts dynamically in the cell during development. The MW of MRPL55 is about 13 kDa.