MRPS10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MRPS10 Polyclonal antibody, PBS Only (16030-1-PBS)

• 

  WB analysis using 16030-1-AP (same clone as 16030-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16030-1-AP (MRPS10 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16030-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 16030-1-AP (same clone as 16030-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16030-1-AP (MRPS10 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16030-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 16030-1-AP (same clone as 16030-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 16030-1-AP (MRPS10 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16030-1-PBS in a different storage buffer formulation.

MRPS10 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16030-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

16030-1-PBS targets MRPS10 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8897

  Product name: Recombinant human MRPS10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of BC012560

  Sequence: MAARTAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTKPVVTISDEPDILYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLQSVHIYKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEEKEESKS

• Full Name: mitochondrial ribosomal protein S10
• Calculated Molecular Weight: 201 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC012560
• Gene Symbol: MRPS10
• Gene ID (NCBI): 55173
• RRID: AB_2254095
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P82664
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.