MRPS12 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MRPS12 Polyclonal antibody (15225-1-AP)

MRPS12 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15225-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

MRP-S12, MT-RPS12, RPMS12, RPS12, RPSM12

• 

  WB analysis using 15225-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15225-1-AP (MRPS12 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 15225-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15225-1-AP (MRPS12 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 15225-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15225-1-AP (MRPS12 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MRPS12 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15225-1-AP targets MRPS12 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7442

  Product name: Recombinant human MRPS12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-138 aa of BC001617

  Sequence: MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK

• Full Name: mitochondrial ribosomal protein S12
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC001617
• Gene Symbol: MRPS12
• Gene ID (NCBI): 6183
• RRID: AB_10597843
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15235
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MRPS12 Polyclonal antibody (Cat# 15225-1-AP) has 6 citations published in Science, Nature Structural & Molecular Biology, PNAS, EMBO Journal, Aging Cell, and BMC Genomics. The research fields span mitochondrial biology, including glutathione homeostasis, ribosome assembly, mitoribosome-related T cell dysfunction and aging, mitochondrial mistranslation linked to stress signaling and cardiovascular disease, and transcriptomic profiling of immune cell aging. All cited applications are Western blot (WB) in human or mouse samples.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Science; Autoregulatory control of mitochondrial glutathione homeostasis; Authors - Yuyang Liu
human	WB	Nat Struct Mol Biol; A roadmap for ribosome assembly in human mitochondria; Authors - Elena Lavdovskaia
human	WB	Proc Natl Acad Sci U S A; Cryoelectron tomography reveals an age-related decline in mitoribosomes that contributes to T cell dysfunction in older individuals; Authors - Jingwen Chen
mouse	WB	EMBO J; Stress signaling and cellular proliferation reverse the effects of mitochondrial mistranslation.; Authors - Nicola Ferreira
mouse	WB	Aging Cell; Mitochondrial mistranslation modulated by metabolic stress causes cardiovascular disease and reduced lifespan.; Authors - Tara R Richman
human	WB	BMC Genomics; Transcriptomic profiles of aging in purified human immune cells.; Authors - Lindsay M Reynolds