MRPS14 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MRPS14 Polyclonal antibody (16301-1-AP)

MRPS14 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16301-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

HSMRPS14, MRP S14, MRP-S14, S14mt, Small ribosomal subunit protein uS14m

• 

  WB analysis using 16301-1-AP

  Rat liver cells were subjected to SDS PAGE followed by western blot with 16301-1-AP (MRPS14 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 16301-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16301-1-AP (MRPS14 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 16301-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16301-1-AP (MRPS14 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 16301-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 16301-1-AP (MRPS14 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 16301-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 16301-1-AP (MRPS14 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 16301-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 16301-1-AP (MRPS14 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MRPS14 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: rat liver tissue
• Positive IHC detected in: mouse liver tissue, human stomach cancer tissue, rat kidney tissue, mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16301-1-AP targets MRPS14 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9018

  Product name: Recombinant human MRPS14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-128 aa of BC009788

  Sequence: MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW

• Full Name: mitochondrial ribosomal protein S14
• Calculated Molecular Weight: 128 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC009788
• Gene Symbol: MRPS14
• Gene ID (NCBI): 63931
• RRID: AB_2878240
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60783
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MRPS14 Polyclonal antibody (Cat# 16301-1-AP) has 7 total citations. These appear in high-impact journals including Cell, Nature Communications, Molecular Cell, Nucleic Acids Research, Nature Structural & Molecular Biology, EMBO Reports, and eLife. The cited research fields center on mitochondrial biology, encompassing mitochondrial ribosome biogenesis, mitoribosomal assembly, mitochondrial gene expression silencing, cotranslational quality control in mitochondria, and the role of the mitochondrial calcium uniporter complex in T-cell immune responses.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; An in vitro system to silence mitochondrial gene expression.; Authors - Luis Daniel Cruz-Zaragoza
human	WB	Nat Commun; Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.; Authors - Hauke S Hillen
human	WB	Mol Cell; Identification of TMEM126A as OXA1L-interacting protein reveals cotranslational quality control in mitochondria; Authors - Sabine Poerschke
human	WB	Nucleic Acids Res; The human Obg protein GTPBP10 is involved in mitoribosomal biogenesis.; Authors - Elena Lavdovskaia
human	WB	Nat Struct Mol Biol; A roadmap for ribosome assembly in human mitochondria; Authors - Elena Lavdovskaia
human	WB	EMBO Rep; Mitochondrial calcium uniporter complex controls T-cell-mediated immune responses; Authors - Magdalena Shumanska