MRPS16 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 82741-2-RR (same clone as 82741-2-PBS)

  WB result of MRPS16 antibody (82741-2-RR; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MRPS16 transfected HeLa cells. This data was developed using the same antibody clone with 82741-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 82741-2-RR (same clone as 82741-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82741-2-RR (MRPS16 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82741-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 82741-2-RR (same clone as 82741-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 82741-2-RR (MRPS16 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82741-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82741-2-RR

  Biolayer interferometry (BLl) kinetic assays of 82741-2-RR against Human MRPS16 were performed. The affinity constant is 0.616 nM.

• Featured Product
• KD/KO Validated

MRPS16 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 82741-2-PBS

Clone No.11D12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

MRP S16, COXPD2, CGI-132, CGI132, CGI 132

---

Product Information

82741-2-PBS targets MRPS16 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9749

  Product name: Recombinant human MRPS16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-137 aa of BC021106

  Sequence: MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET

• Full Name: mitochondrial ribosomal protein S16
• Calculated Molecular Weight: 137 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC021106
• Gene Symbol: MRPS16
• Gene ID (NCBI): 51021
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y3D3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.