• Featured Product
  • KD/KO Validated

MRPS18A Recombinant monoclonal antibody

MRPS18A Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 84201-1-RR
Clone No.240850C3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

MRP S18 3, Large ribosomal subunit protein bS18a, HumanS18b, 39S ribosomal protein S18a, mitochondrial, 39S ribosomal protein S18-3, mitochondrial

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, A549 cells, HeLa cells, L02 cells, MCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84201-1-RR targets MRPS18A in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9011

Product name: Recombinant human MRPS18A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-196 aa of BC010364

Sequence: MAALKALVSGCGRLLRGLLAGPAATSWSRLPARGFREVVETQEGKTTIIEGRITATPKESPNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH

Predict reactive species
Full Name mitochondrial ribosomal protein S18A
Calculated Molecular Weight 196 aa, 22 kDa
Observed Molecular Weight15 kDa
GenBank Accession NumberBC010364
Gene Symbol MRPS18A
Gene ID (NCBI) 55168
RRIDAB_3671757
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9NVS2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MRPS18A (Mitochondrial Ribosomal Protein S18A) is a protein coding gene. It encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The increased expression of MRPS18A in cancer cells is explained by the increased energy metabolism of cancer cells and may pave the way for new diagnostic and therapeutic avenues to be explored (PMID: 28056857).

Protocols

Product Specific Protocols
WB protocol for MRPS18A antibody 84201-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...