MRPS24 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MRPS24 Polyclonal antibody (16213-1-AP)

MRPS24 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16213-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

bMRP 47, bMRP47, bMRP-47, HSPC335, MRP S24

• 

  WB analysis using 16213-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16213-1-AP (MRPS24 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 16213-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 16213-1-AP (MRPS24 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MRPS24 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, L02 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16213-1-AP targets MRPS24 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9211

  Product name: Recombinant human MRPS24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of BC012167

  Sequence: MAASVCSGLLGPRVLSWSRELPCAWRALHTSPVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMWGTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKYL

• Full Name: mitochondrial ribosomal protein S24
• Calculated Molecular Weight: 167 aa, 19 kDa
• Observed Molecular Weight: 15-19 kDa
• GenBank Accession Number: BC012167
• Gene Symbol: MRPS24
• Gene ID (NCBI): 64951
• RRID: AB_2180356
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96EL2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MRPS24 Polyclonal antibody (Cat# 16213-1-AP) has 2 total citations. These appear in Cell Death Discovery and Methods in Molecular Biology. The cited research spans cancer biology, specifically esophageal squamous cell carcinoma proliferation and migration, and mitochondrial ribosome biogenesis in tissue-specific knockout mice. Both studies used the antibody for Western blot in mouse samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Death Discov; Circular RNA circTRPS1-2 inhibits the proliferation and migration of esophageal squamous cell carcinoma by reducing the production of ribosomes; Authors - Renchang Zhao
mouse	WB	Methods Mol Biol; Linear Density Sucrose Gradients to Study Mitoribosomal Biogenesis in Tissue-Specific Knockout Mice.; Authors - Benedetta Ruzzenente