MRPS6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MRPS6 Polyclonal antibody, PBS Only (16273-1-PBS)

• 

  WB analysis using 16273-1-AP (same clone as 16273-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16273-1-AP (MRPS6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16273-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 16273-1-AP (same clone as 16273-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 16273-1-AP (MRPS6 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16273-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 16273-1-AP (same clone as 16273-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 16273-1-AP (MRPS6 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16273-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 16273-1-AP (same clone as 16273-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 16273-1-AP (MRPS6 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16273-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16273-1-AP (same clone as 16273-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MRPS6 antibody (16273-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 16273-1-PBS in a different storage buffer formulation.

MRPS6 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 16273-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Small ribosomal subunit protein bS6m, S6mt, RPMS6, MRP-S6, MRP S6

---

Product Information

16273-1-PBS targets MRPS6 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9345

  Product name: Recombinant human MRPS6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-125 aa of BC010076

  Sequence: MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK

• Full Name: mitochondrial ribosomal protein S6
• Calculated Molecular Weight: 125 aa, 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC010076
• Gene Symbol: MRPS6
• Gene ID (NCBI): 64968
• RRID: AB_3669236
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P82932
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.