MSH2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MSH2 Polyclonal antibody (15520-1-AP)

• Featured Product
• KD/KO Validated

MSH2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 15520-1-AP Copied!

Publications (36)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

MSH 2

• 

  WB analysis using 15520-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15520-1-AP (MSH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15520-1-AP

  WB results of MSH2 (15520-1-AP, 1:5000) antibody with si-Control and si-MSH2 transfected HeLa cells..

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15520-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15520-1-AP (MSH2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 15520-1-AP

  IP result of anti-MSH2 (IP:15520-1-AP, 5ug; Detection:15520-1-AP 1:500) with HeLa cells lysate 2000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 15520-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15520-1-AP (MSH2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 15520-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15520-1-AP (MSH2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsil using 15520-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsil using 15520-1-AP (MSH2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsil using 15520-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsil using 15520-1-AP (MSH2 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 15520-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MSH2 antibody (15520-1-AP) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 15520-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human MSH2 (15520-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MSH2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, Caco-2 cells, SW480 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human stomach cancer tissue, human tonsil tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15520-1-AP targets MSH2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7835

  Product name: Recombinant human MSH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 585-934 aa of BC021566

  Sequence: SSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQGRIILKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT

• Full Name: mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 100 kDa-105 kDa
• GenBank Accession Number: BC021566
• Gene Symbol: MSH2
• Gene ID (NCBI): 4436
• RRID: AB_2144799
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43246
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MSH2, named for its homologous to the E.coli MutS gene, takes part in DNA mismatch repair(MMR) to maintain the stability of DNA. MSH2 contains a helix-turn-helix domain, which responds for binding to DNA. Also, MSH2 has a direct role in mutation avoidance and micro-satellite stability in cell.

Publications

What published studies show

MSH2 antibody (Cat# 15520-1-AP) has 36 citations published in journals including Nature Cancer, Cell Metabolism, PNAS, Leukemia, Cell Death & Disease, Journal of Biological Chemistry, Experimental Molecular Medicine, and Cancer Letters. Research fields encompass DNA mismatch repair mechanisms, multiple cancer types (colorectal, gastric, glioma, ovarian, endometrial, pancreatic, hepatocellular), immunotherapy response, Lynch syndrome, epigenetics, and Huntington's disease.

Automatically generated from the 36 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Cell Metab; Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer; Authors - Yu Jiang
human	WB	Nat Cancer; Chemotherapy and mismatch repair deficiency cooperate to fuel TP53 mutagenesis and ALL relapse.; Authors - Fan Yang ; KO Validated
human	WB	Drug Resist Updat; Intercellular adhesion molecule-1 suppresses TMZ chemosensitivity in acquired TMZ-resistant gliomas by increasing assembly of ABCB1 on the membrane; Authors - Xin Zhang
human	WB	Exp Mol Med; PMID: 23143558; Authors - He Yu-qi YQ
	WB	Exp Mol Med; The long non-coding RNA-encoded microprotein MKKS3 drives colorectal cancer chemoresistance; Authors - Hui-Fang Hu
human	WB,IHC,IF	Cell Death Dis; Nrf2 overexpression increases risk of high tumor mutation burden in acute myeloid leukemia by inhibiting MSH2.; Authors - Ping Liu