MSH2 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MSH2 Recombinant monoclonal antibody, PBS Only (82775-1-PBS)

• Featured Product
• KD/KO Validated

MSH2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 82775-1-PBS

Clone No.6O4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

MSH 2

• 

  WB analysis using 82775-1-RR (same clone as 82775-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82775-1-RR (MSH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 82775-1-RR (same clone as 82775-1-PBS)

  WB result of MSH2 antibody (82775-1-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MSH2 transfected HeLa cells. This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colorectal cancer using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colorectal cancer tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 82775-1-RR (MSH2 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 82775-1-RR (MSH2 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colorectal cancer using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colorectal cancer tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colorectal cancer using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colorectal cancer tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colorectal cancer using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colorectal cancer tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 82775-1-RR (same clone as 82775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82775-1-RR (MSH2 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 82775-1-RR (same clone as 82775-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MSH2 antibody (82775-1-RR, Clone: 6O4 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 82775-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 82775-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82775-1-RR against Human MSH2 were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

82775-1-PBS targets MSH2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7835

  Product name: Recombinant human MSH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 585-934 aa of BC021566

  Sequence: SSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQGRIILKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT

• Full Name: mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 100 kDa-105 kDa
• GenBank Accession Number: BC021566
• Gene Symbol: MSH2
• Gene ID (NCBI): 4436
• RRID: AB_3086533
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P43246
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MSH2, named for its homologous to the E.coli MutS gene, takes part in DNA mismatch repair(MMR) to maintain the stability of DNA. MSH2 contains a helix-turn-helix domain, which responds for binding to DNA. Also, MSH2 has a direct role in mutation avoidance and micro-satellite stability in cell.