• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated MSH6 Monoclonal antibody

MSH6 Monoclonal Antibody for FC (Intra)

Cat No. CL647-66172
Clone No.2E10B2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

FC (Intra)

hMSH6, GTMBP, GTBP, G/T mismatch-binding protein, G/T mismatch binding protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-66172 targets MSH6 in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12645

Product name: Recombinant human MSH6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-400 aa of BC004246

Sequence: MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPE

Predict reactive species
Full Name mutS homolog 6 (E. coli)
Calculated Molecular Weight 153 kDa
Observed Molecular Weight 160 kDa
GenBank Accession NumberBC004246
Gene Symbol MSH6
Gene ID (NCBI) 2956
RRIDAB_2935044
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP52701
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MSH6, also named as DNA mismatch repair protein Msh6 or GTMBP, is a 1360 amino acid protein, which contains one PWWP domain and belongs to the DNA mismatch repair MutS family. MSH6 localizes in the nucleus and is a component of the post-replicative DNA mismatch repair system. Msh2 and Msh6 form a protein complex required to repair mismatches generated during DNA replication.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 MSH6 antibody CL647-66172Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...