MSI1 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Cytometric bead array sample test of MP02619-1

  The mean MSI1 concentration was determined to be 12.9 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load, 9.0 ng/mL in Caco-2 cell extract based on a 1.3 mg/mL extract load, 20.7 ng/mL in HEK-293T cell extract based on a 2.6 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02619-1

  Cytometric bead array standard curve of MP02619-1, MSI1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86723-1-PBS. Detection antibody: 86723-2-PBS. Standard: Ag26042. Range: 0.312-40 ng/mL.

MSI1 Uni-rAb^® Recombinant Antibody for IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 86723-2-PBS

Clone No.251695G5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

Musashi 1, musashi homolog 1 (Drosophila), Musashi-1, RNA-binding protein Musashi homolog 1

---

Product Information

86723-2-PBS targets MSI1 as part of a matched antibody pair:

MP02619-1: 86723-1-PBS capture and 86723-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26042

  Product name: Recombinant human MSI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-83 aa of BC146463

  Sequence: METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRH

• Full Name: musashi homolog 1 (Drosophila)
• Calculated Molecular Weight: 362 aa, 39 kDa
• GenBank Accession Number: BC146463
• Gene Symbol: MSI1
• Gene ID (NCBI): 4440
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43347
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.