• Featured Product
  • KD/KO Validated

Moesin Recombinant monoclonal antibody

Moesin Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 82009-1-RR
Clone No.3B8

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

MSN, Membrane-organizing extension spike protein, 3B8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, SGC-7901 cells, NK-92 cells, Jurkat cells, C6 cells, RAW 264.7 cells
Positive IHC detected inmouse kidney tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82009-1-RR targets Moesin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9623

Product name: Recombinant human MSN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-294 aa of BC017293

Sequence: MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRR

Predict reactive species
Full Name moesin
Calculated Molecular Weight 577 aa, 68 kDa
Observed Molecular Weight 68-70 kDa
GenBank Accession NumberBC017293
Gene Symbol Moesin
Gene ID (NCBI) 4478
RRIDAB_2935596
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP26038
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Moesin belongs to the ezrin-radixin-moesin (ERM) family of proteins which act as cross-linkers between membrane and actin cytoskeleton. ERM proteins provide structural links to strengthen the cell cortex and facilitate several key cellular processes, including membrane dynamics, substrate adhesion, cell survival, cell adhesion, and motility. The function of ERM proteins is highly reliant on phosphorylation induced conformational changes in response to growth factor, chemokine, and antigen stimulation. This antibody may cross-react with ezrin or radixin with molecular weights around 68-70 kDa.

Protocols

Product Specific Protocols
IF protocol for Moesin antibody 82009-1-RRDownload protocol
IHC protocol for Moesin antibody 82009-1-RRDownload protocol
WB protocol for Moesin antibody 82009-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...