MSRA Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86358-1-RR (same clone as 86358-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86358-1-RR (MSRA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86358-1-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 86358-1-RR (same clone as 86358-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using MSRA antibody (86358-1-RR, Clone: 251025H2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86358-1-PBS in a different storage buffer formulation.

MSRA Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86358-1-PBS

Clone No.251025H2

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:1.8.4.11, Mitochondrial peptide methionine sulfoxide reductase, Peptide Met(O) reductase, Peptide-methionine, PMSR

---

Product Information

86358-1-PBS targets MSRA in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6053

  Product name: Recombinant human MSRA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-235 aa of BC054033

  Sequence: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

• Full Name: methionine sulfoxide reductase A
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 24-26 kDa
• GenBank Accession Number: BC054033
• Gene Symbol: MSRA
• Gene ID (NCBI): 4482
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UJ68
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Methionine sulfoxide reductase A (MSRA) is an antioxidant enzyme found in all domains of life that catalyzes the reduction of methionine-S-sulfoxide (MSO) to methionine in proteins and free amino acids (PMID: 28874471). MSRA has some isoforms with MW of 19~26 kDa. MSRA functions in the repair of oxidatively damaged proteins to restore biological activity. Transfection of MSRA reduced colony formation and the invasiveness of HCC cell lines. Studies have demonstrated the downregulation of MSRA in multiple human tumors, including breast cancers and its levels have been linked to advanced tumor grades (PMID: 20937881).