MT2A Polyclonal antibody

• 

  IHC staining of human urothelial carcinoma using 20809-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 20809-1-AP (MT2A Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human urothelial carcinoma using 20809-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 20809-1-AP (MT2A Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MT2A Polyclonal Antibody for IHC, ELISA

Cat No. 20809-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

IHC, ELISA

Synonyms

CES1, Metallothionein 2, metallothionein 2A, Metallothionein II, MT 2, MT II, MT2, MT2A

---

Tested Applications

• Positive IHC detected in: human urothelial carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

20809-1-AP targets MT2A in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14761

  Product name: Recombinant human MT2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-61 aa of BC007034

  Sequence: MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA

• Full Name: metallothionein 2A
• Calculated Molecular Weight: 61 aa, 6 kDa
• GenBank Accession Number: BC007034
• Gene Symbol: MT2A
• Gene ID (NCBI): 4502
• RRID: AB_2878744
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02795
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
chicken	IHC	Poult Sci; The capability of L-carnitine-mediated antioxidant on cock during aging: evidence for the improved semen quality and enhanced testicular expressions of GnRH1, GnRHR, and melatonin receptors MT 1/2.; Authors - Abdelmotaleb A Elokil