MTA1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MTA1 Recombinant monoclonal antibody, PBS Only (87979-1-PBS)

• 

  WB analysis using 87979-1-RR (same clone as 87979-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87979-1-RR (MTA1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87979-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 87979-1-RR (same clone as 87979-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using MTA1 antibody (87979-1-RR, Clone: 253519C10 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87979-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 87979-1-RR (same clone as 87979-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MTA1 antibody (87979-1-RR, Clone: 253519C10 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87979-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87979-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87979-1-RR against Human MTA1 were performed. The affinity constant is 7.08 nM.

MTA1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 87979-1-PBS

Clone No.253519C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

metastasis associated 1, MTA 1

---

Product Information

87979-1-PBS targets MTA1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30994

  Product name: Recombinant human MTA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 513-678 aa of NM_004689

  Sequence: TARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETK

• Full Name: metastasis associated 1
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: NM_004689
• Gene Symbol: MTA1
• Gene ID (NCBI): 9112
• RRID: AB_3745844
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13330
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Metastasis-associated protein 1 (MTA1) is a member of the MTA family, which is involved in regulating DNA-based biological processes (PMID: 25332144). MTA1 is an integral part of the nucleosome remodeling histone deacetylase complex (NuRD complex) and regulates nucleosome remodeling and deacetylation by stabilizing the NuRD complex and related proteins (PMID: 12419236). MTA1 expression is associated with tumor malignancy in several cancers.