MTAP Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of HeLa using 83005-5-RR (same clone as 83005-5-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using MTAP antibody (83005-5-RR, Clone: 240030E5 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 83005-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83005-5-RR (same clone as 83005-5-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug MTAP Recombinant antibody (83005-5-RR, Clone:240030E5) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83005-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83005-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83005-5-RR against Human MTAP were performed. The affinity constant is 1.54 nM.

MTAP Uni-rAb^® Recombinant Antibody for IF/ICC, Indirect ELISA

Cat No. 83005-5-PBS

Clone No.240030E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Synonyms

MTA phosphorylase, MSAP, EC:2.4.2.28, c86fus, 5'-methylthioadenosine phosphorylase

---

Product Information

83005-5-PBS targets MTAP in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2051

  Product name: Recombinant human MTAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-154 aa of BC018625

  Sequence: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS

• Full Name: methylthioadenosine phosphorylase
• Calculated Molecular Weight: 283 aa, 31 kDa
• GenBank Accession Number: BC018625
• Gene Symbol: MTAP
• Gene ID (NCBI): 4507
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q13126
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MTAP is a 5-deoxy-5-methylthioadenosine (MTA) phosphorylase, converting MTA to salvageable intermediates including adenine and 5-methylthioribose-1-phosphate. MTAP is abundant in normal cells, but it is frequently found to be deleted in a variety of cancers. Its deficiency is common in cancer cell lines as well as in primary leukemia, lung cancer, melanoma, bladder cancer, gliomas and breast cancer.