MTF2 Monoclonal antibody, PBS Only

MTF2 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68713-1-PBS
Clone No.2E5D5

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Rat, Rabbit, Mouse

Applications

WB, Indirect ELISA

dJ976O13.2, hPCl2, M96, MTF2, PCL2, Polycomb like protein 2, RP5 976O13.1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68713-1-PBS targets MTF2 in WB, Indirect ELISA applications and shows reactivity with Human, Rat, Rabbit, Mouse samples.

Tested Reactivity Human, Rat, Rabbit, Mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9384

Product name: Recombinant human MTF2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 187-536 aa of BC010013

Sequence: ADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMEVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS

Predict reactive species
Full Name metal response element binding transcription factor 2
Calculated Molecular Weight 536 aa, 61 kDa
Observed Molecular Weight55 kDa, 60 kDa, 75 kDa
GenBank Accession NumberBC010013
Gene Symbol MTF2
Gene ID (NCBI) 22823
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y483
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MTF2, also named as Metal-response element-binding transcription factor 2, is a 593 amino acid protein. It exists several isoforms and the range of the molecular weight of isoforms are about 55-60 kDa and 29 kDa. MTF2 contains 2 PHD-type zinc fingers and belongs to the Polycomblike family. MTF2 acts by binding to H3K36me3, a mark for transcriptional activation, and recruiting the PRC2 complex, leading to enhance PRC2 H3K27me3 methylation activity and regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation.

Loading...
||
New chat Able
正在加载,请稍候...