MTHFD1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84884-5-RR (same clone as 84884-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84884-5-RR (MTHFD1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84884-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 84884-5-RR (same clone as 84884-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 84884-5-RR (MTHFD1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84884-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 84884-5-RR (same clone as 84884-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 84884-5-RR (MTHFD1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84884-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 84884-5-RR (same clone as 84884-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 84884-5-RR (MTHFD1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84884-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 84884-5-RR (same clone as 84884-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 84884-5-RR (MTHFD1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84884-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 84884-5-RR (same clone as 84884-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using MTHFD1 antibody (84884-5-RR, Clone: 242388F1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84884-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84884-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84884-5-RR against Human MTHFD1 were performed. The affinity constant is below 1 pM.

MTHFD1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84884-5-PBS

Clone No.242388F1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

242388F1, C-1-tetrahydrofolate synthase, cytoplasmic, C-1-tetrahydrofolate synthase, cytoplasmic, N-terminally processed, C1-THF synthase, Epididymis secretory sperm binding protein

---

Product Information

84884-5-PBS targets MTHFD1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1225

  Product name: Recombinant human MTHFD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 536-935 aa of BC009806

  Sequence: TNDRFLRKITIGQAPTEKGHTRTAQFDISVASEIMAVLALTTSLEDMRERLGKMVVASSKKGEPVSAEDLGVSGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSIIADQIALKLVGPEGFVVTEAGFGADIGMEKFFNIKCRYSGLCPHVVVLVATVRALKMHGGGPTVTAGLPLPKAYIQENLELVEKGFSNLKKQIENARMFGIPVVVAVNAFKTDTESELDLISRLSREHGAFDAVKCTHWAEGGKGALALAQAVQRAAQAPSSFQLLYDLKLPVEDKIRIIAQKIYGADDIELLPEAQHKAEVYTKQGFGNLPICMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPGLPTRPCFYDIDLDPETEQVNGLF

• Full Name: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase
• Calculated Molecular Weight: 101 kDa
• Observed Molecular Weight: 101-110 kDa
• GenBank Accession Number: BC009806
• Gene Symbol: MTHFD1
• Gene ID (NCBI): 4522
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P11586
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MTHFD1 is a trifunctional enzyme involved in the pathway tetrahydrofolate interconversion, which is part of One-carbon metabolism. MTHFD1 is associated with HCC and CRC progression. It has been reported that MTHFD-deficient patient fibroblasts exhibit enriched MTHFD1 in the nucleus which is critical for de novo dTMP synthesis.(PMID: 31133746, 30997850, 31421459, 25548164)