• Featured Product
  • KD/KO Validated

MTIF3 Polyclonal antibody

MTIF3 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 14219-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IP, ELISA

IF 3(Mt), IF 3mt, IF3(mt), IF3mt, MTIF3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, human preadipocyte cells, HT-29 cells, HeLa cells, HepG2 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman liver tissue, mouse testis tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 7 publications below

Product Information

14219-1-AP targets MTIF3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5457

Product name: Recombinant human MTIF3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-278 aa of BC046166

Sequence: MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKIKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

Predict reactive species
Full Name mitochondrial translational initiation factor 3
Calculated Molecular Weight 32 kDa
Observed Molecular Weight 29 kDa
GenBank Accession NumberBC046166
Gene Symbol MTIF3
Gene ID (NCBI) 219402
RRIDAB_10638621
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H2K0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MTIF3, also named as DC38, belongs to the IF-3 family. MTIF3 encodes a 29 kDa protein that promotes formation of the initiation complex on the mitochondrial 55S ribosome, thereby playing an active role in initiation of translation. Like bacterial IF3, MTIF3 is believed to bind first to the small mitoribosomal subunit to keep it dissociated from the large subunit during initiation. After binding of MTIF3, mRNA and formylated initiator methionyl-tRNA (fMet-tRNAifMet) bind to the small mitoribosomal subunit. The large subunit then joins the small subunit to form an elongation-competent ribosome (PMID:20887776, 31350787).

Protocols

Product Specific Protocols
IHC protocol for MTIF3 antibody 14219-1-APDownload protocol
IP protocol for MTIF3 antibody 14219-1-APDownload protocol
WB protocol for MTIF3 antibody 14219-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Sci Adv

Fidelity of translation initiation is required for coordinated respiratory complex assembly.

Authors - Danielle L Rudler
mouseWB

EMBO J

Stress signaling and cellular proliferation reverse the effects of mitochondrial mistranslation.

Authors - Nicola Ferreira

Am J Surg Pathol

The Relationship Between Mismatch Repair Deficiency and PD-L1 Expression in Breast Carcinoma.

Authors - Anne M Mills
humanWB

Sci Rep

Initiation Factor 3 is Dispensable For Mitochondrial Translation in Cultured Human Cells.

Authors - Ivan V Chicherin

Clin Immunol

Novel minor HLA DR associated antigens in type 1 diabetes.

Authors - Denise Müller
ratWB

Sci Total Environ

Fluoride impairs mitochondrial translation by targeting miR-221-3p/c-Fos/RMND1 axis contributing to neurodevelopment defects

Authors - Dongjie Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Mi (Verified Customer) (02-10-2023)

It works pretty well! We tried different antibodies from other suppliers, and this one gives a specific band, as we expected from the knockout samples. Although, we did observe some non-specific bands, having a knockout control would validate the target band.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: adipocytes
Loading...
||
New chat Able
正在加载,请稍候...