MTMR15 Recombinant monoclonal antibody

• 

  FC experiment of K-562 using 83622-6-RR

  1x10^6 K-562 cells were intracellularly stained with 0.25 ug Mtmr15 Recombinant Antibody (83622-6-RR, Clone:240629E4) (red), or 0.25 ug Isotype Control (blue) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• 

  FC experiment of A431 using 83622-6-RR

  1x10^6 A431 cells were intracellularly stained with 0.25 ug Mtmr15 Recombinant Antibody (83622-6-RR, Clone:240629E4)(red), or 0.25 ug Isotype Control (blue) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• 

  Affinity and Kinetic Characterization of 83622-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83622-6-RR against Human MTMR15 were performed. The affinity constant is 3.74 nM.

MTMR15 Uni-rAb^® Recombinant Antibody for FC (Intra), ELISA

Cat No. 83622-6-RR

Clone No.240629E4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra), ELISA

Synonyms

hFAN1, Fanconi-associated nuclease 1, FANCD2/FANCI-associated nuclease 1, FAN1, EC:3.1.21.-

---

Tested Applications

• Positive FC (Intra) detected in: K-562 cells, A431 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83622-6-RR targets MTMR15 in FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11651

  Product name: Recombinant human MTMR15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 186-534 aa of BC047882

  Sequence: STVVKSLIDNSSEIEDEDQILENSSQKENVFKCDSLKEECIPEHMVRESKIMEAESQKATRECEKSALTPGFSDNAIMLFSPDFTLRNTLKSTSEDSLVKQECIKEVVEKREACHCEEVKMTVASEAKIQLSDSEAKSHSSADDASAWSNIQEAPLQDDSCLNNDIPHSIPLEQGSSCNGPGQTTGHPYYLRSFLVVLKTVLENEDDMLLFDEQEKGIVTKFYQLSATGQKLYVRLFQRKLSWIKMTKLEYEEIALDLTPVIEELTNAGFLQTESELQELSEVLELLSAPELKSLAKTFHLVNPNGQKQQLVDAFLKLAKQRSVCTWGKNKPGIGAVILKRFCWLLLQ

• Full Name: myotubularin related protein 15
• Calculated Molecular Weight: 60 kDa, 114 kDa
• GenBank Accession Number: BC047882
• Gene Symbol: MTMR15
• Gene ID (NCBI): 22909
• RRID: AB_3671235
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9Y2M0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MTMR15, also named as FAN1 and KIAA1018, is a nuclease required for the repair of DNA interstrand cross-links (ICL) recruited at sites of DNA damage by monoubiquitinated FANCD2. It is specifically involved in repair of ICL-induced DNA breaks by being required for efficient homologous recombination, probably in the resolution of homologous recombination intermediates. MTMR15 has some isoforms with MW 114 kDa and 60 kDa. The MW will be migrated to 120-140 kDa and 63-68 kDa with modification.