MTMR7 Polyclonal antibody

• 

  WB analysis using 25990-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25990-1-AP (MTMR7 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 25990-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25990-1-AP (MTMR7 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25990-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25990-1-AP (MTMR7 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 25990-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 25990-1-AP (MTMR7 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

MTMR7 Polyclonal Antibody for WB, ELISA

Cat No. 25990-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, CoIP, ELISA

Synonyms

MTMR7, myotubularin related protein 7

---

Tested Applications

• Positive WB detected in: Neuro-2a cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

25990-1-AP targets MTMR7 in WB, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23170

  Product name: Recombinant human MTMR7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 514-660 aa of BC130577

  Sequence: RQSVTDYLMAVKEETQQLEEELEALEERLEKIQKVQLNCTKVKSKQSEPSKHSGFSTSDNSIANTPQDYSGNMKSFPSRSPSQGDEDSALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFLTA

• Full Name: myotubularin related protein 7
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC130577
• Gene Symbol: MTMR7
• Gene ID (NCBI): 9108
• RRID: AB_2880323
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y216
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	PLoS One; MTMR7 regulates human spermatogonial stem cells proliferation and migration via targeting FLNB; Authors - Nianchao Zhou ; KD Validated
mouse	WB,CoIP	Mol Cell Biochem; MTMR7 attenuates the proliferation and migration of pulmonary arterial smooth muscle cells in pulmonary hypertension by suppressing ERK/STAT3 signaling; Authors - Jia Wang