MTMR9 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MTMR9 Polyclonal antibody, PBS Only (30468-1-PBS)

• 

  WB analysis using 30468-1-AP (same clone as 30468-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30468-1-AP (MTMR9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30468-1-PBS in a different storage buffer formulation.

MTMR9 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30468-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

30468-1-PBS targets MTMR9 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33501

  Product name: Recombinant human MTMR9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 165-393 aa of BC022003

  Sequence: PKSIDDEALRKVATFRHGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLNVAQQTRAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIKLVEACNDQTHNMDRWLSKLEASNWLTHIKEILTTACLAAQCIDREGASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRGFEALIEREWLQAGHPFQQRCALSAYCNTKQKWE

• Full Name: myotubularin related protein 9
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 60-63 kDa
• GenBank Accession Number: BC022003
• Gene Symbol: MTMR9
• Gene ID (NCBI): 66036
• RRID: AB_3669724
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96QG7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.