MTRF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MTRF1 Polyclonal antibody, PBS Only (11581-1-PBS)

• 

  WB analysis of mouse liver using 11581-1-AP (same clone as 11581-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11581-1-AP (MTRF1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11581-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 11581-1-AP (same clone as 11581-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11581-1-AP (MTRF1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11581-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 11581-1-AP (same clone as 11581-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11581-1-AP (MTRF1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11581-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 11581-1-AP (same clone as 11581-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11581-1-AP (MTRF1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11581-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 11581-1-AP (same clone as 11581-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas using 11581-1-AP (MTRF1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11581-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 11581-1-AP (same clone as 11581-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 11581-1-AP (MTRF1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11581-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 11581-1-AP (same clone as 11581-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 11581-1-AP (MTRF1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11581-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 11581-1-AP (same clone as 11581-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas using 11581-1-AP (MTRF1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11581-1-PBS in a different storage buffer formulation.

MTRF1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11581-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11581-1-PBS targets MTRF1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2170

  Product name: Recombinant human MTRF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC027731

  Sequence: MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIYQEIQETEQAIEELESMCKKTESCSVAQAGMQ

• Full Name: mitochondrial translational release factor 1
• Calculated Molecular Weight: 445 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC027731
• Gene Symbol: MTRF1
• Gene ID (NCBI): 9617
• RRID: AB_10734595
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75570
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.