MUC17 Recombinant monoclonal antibody, PBS Only (Detector)

MUC17 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83528-3-PBS
Clone No.240351E2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

MUC 17, MUC 3, MUC-17, MUC3, MUC-3

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83528-3-PBS targets MUC17 as part of a matched antibody pair:

MP00499-1: 83528-2-PBS capture and 83528-3-PBS detection (validated in Cytometric bead array)

MP00499-2: 83528-1-PBS capture and 83528-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0413

Product name: Recombinant Human MUC17 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 4131-4390 aa of BC126315

Sequence: RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL

Predict reactive species
Full Name mucin 17, cell surface associated
Calculated Molecular Weight 4493 aa, 494 kDa
GenBank Accession NumberBC126315
Gene Symbol MUC17
Gene ID (NCBI) 140453
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ685J3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MUC17 is a membrane-bound mucin that provides protection to gut epithelial cells. MUC17 contains about 60 tandem repeats, with each repeat being around 60 aa. N-glycosylation enables the encoded protein to localize on the cell surface, while the C-terminus interacts with the scaffold protein PDZ domain containing 1 (PDZK1).

Loading...
||
New chat Able
正在加载,请稍候...