MUC5B Polyclonal antibody

• 

  IHC staining of human lung using 28118-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 28118-1-AP (MUC5B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 28118-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 28118-1-AP (MUC5B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse lung using 28118-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse lung tissue using MUC5B antibody (28118-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse lung using 28118-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse lung tissue using MUC5B antibody (28118-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

MUC5B Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 28118-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF-P, ELISA

Synonyms

MUC9, MUC5, MG1

---

Tested Applications

• Positive IHC detected in: human lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse lung tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

28118-1-AP targets MUC5B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27886

  Product name: Recombinant human MUC5B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 5548-5716 aa of NM_002458

  Sequence: MLSGDTQDPTVQCQEDACNNTTCPQGFEYKRVAGQCCGECVQTACLTPDGQPVQLNETWVNSHVDNCTVYLCEAEGGVHLLTPQPASCPDVSSCRGSLRKTGCCYSCEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVP

• Full Name: mucin 5B, oligomeric mucus/gel-forming
• Calculated Molecular Weight: 596 kDa
• GenBank Accession Number: NM_002458
• Gene Symbol: MUC5B
• Gene ID (NCBI): 727897
• RRID: AB_2881067
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HC84
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Clin Transl Med; Single-cell transcriptomes reveal heterogeneity of high-grade serous ovarian carcinoma.; Authors - Qian Hao
rat	WB	J Ethnopharmacol; Synergistic effect of constituent drugs of Baibutang on improving Yin-deficiency pulmonary fibrosis in rats; Authors - San Fu
pig	IF	Front Immunol; Establishment of a porcine bronchial epithelial cell line and its application to study innate immunity in the respiratory epithelium; Authors - Kohtaro Fukuyama
human	WB	PLoS One; Assessment of polymeric mucin-drug interactions; Authors - Hisanao Kishimoto
mouse	IHC	Cells; Bleomycin-Induced Pulmonary Fibrosis in Transgenic Mice Carrying the Human MUC5B rs35705950 Variant; Authors - Suphachai Tharavecharak