MUDENG Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MUDENG Polyclonal antibody (26567-1-AP)

MUDENG Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26567-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

Adaptor-related protein complex 5 subunit mu-1, AP-5 complex subunit mu-1, AP5M1, C14orf108, Mu-2-related death-inducing protein

• 

  WB analysis of HL-60 using 26567-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 26567-1-AP (MUDENG antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse cerebellum using 26567-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 26567-1-AP (MUDENG Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 26567-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 26567-1-AP (MUDENG antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat lung using 26567-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 26567-1-AP (MUDENG antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 26567-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 26567-1-AP (MUDENG antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 26567-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 26567-1-AP (MUDENG antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 26567-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 26567-1-AP (MUDENG antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 26567-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26567-1-AP (MUDENG antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 26567-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 26567-1-AP (MUDENG antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MUDENG in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells
• Positive IHC detected in: human ovary cancer tissue, mouse kidney tissue, rat lung tissue, rat kidney tissue, rat stomach tissue, mouse lung tissue, mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26567-1-AP targets MUDENG in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23486

  Product name: Recombinant human MUDENG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-284 aa of BC013174

  Sequence: MAQRAVWLISHEPGTPLCGTVRFSRRYPTVEKRARVFNGASYVPVPEDGPFLKALLFELRLLDDDKDFVESRDSCSRINKTSIYGLLIGGEELWPVVAFLKNDMIYACVPLVEQTLSPRPPLISVSGVSQGFEFLFGIQDFLYSGQKNDSELNTKLSQLPDLLLQACPFGTLLDANLQNSLDNTNFASVTQPQKQPAWKTGTYKGKPQVSISITEKVKSMQYDKQGIADTWQVVGTVTCKVRFFSGTCFIVLFNIWRKVKFASCILNNIFYFHLKQQFLNGRVM

• Full Name: MU-2/AP1M2 domain containing, death-inducing
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC013174
• Gene Symbol: MUDENG
• Gene ID (NCBI): 55745
• RRID: AB_2880555
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H0R1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MUDENG polyclonal antibody (Cat# 26567-1-AP) has 2 total citations. These appear in Chemosphere and Animals (Basel). The cited research spans renal cancer risk assessment involving organophosphate flame retardant TDCPP in humans, and cAMP signaling pathway-mediated HPT axis regulation of spermatogenesis in sheep. Both studies utilized the antibody for Western blot applications.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Chemosphere; Organophosphate flame retardant TDCPP: A risk factor for renal cancer?; Authors - Xuan Zhou
sheep	WB	Animals (Basel); DIA Proteomics Reveals the Mechanism of cAMP Signaling Pathway-Mediated HPT Axis in Regulating Spermatogenesis of Hu Sheep.; Authors - Lina Zhu