MVB12B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MVB12B Polyclonal antibody (33961-1-AP)

• 

  WB analysis using 33961-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33961-1-AP (FAM125B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

MVB12B Polyclonal Antibody for WB, ELISA

Cat No. 33961-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C9orf28, ESCRT-I complex subunit MVB12B, FAM125B, Multivesicular body subunit 12B, Protein FAM125B

---

Tested Applications

• Positive WB detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33961-1-AP targets MVB12B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40577

  Product name: Recombinant human FAM125B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-200 aa of BC000122

  Sequence: TMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDS

• Full Name: family with sequence similarity 125, member B
• Calculated Molecular Weight: 319 aa, 36 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC000122
• Gene Symbol: FAM125B
• Gene ID (NCBI): 89853
• RRID: AB_3743125
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9H7P6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM125B/MVB12B gene codes for a component of a membrane complex involved in vesicular trafficking process, a function similar to that of the Caveolin genes (CAV1 and CAV2) which have previously been associated with primary open-angle glaucoma (PMID: 24518671). MVB12b is also a target for TANK-binding kinase 1 phosphorylation, which is essential for the sorting of DNA into EVs and stimulation of bystander cells (PMID: 30804548).