MYB/c-Myb Monoclonal antibody, PBS Only

MYB/c-Myb Monoclonal Antibody for WB, Indirect ELISA
Cat No. 60550-1-PBS
Clone No.2A12C2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig

Applications

WB, Indirect ELISA

MYB, c-Myb, Transcriptional activator Myb, Proto-oncogene c-Myb, Proto oncogene c Myb

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60550-1-PBS targets MYB/c-Myb in WB, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

Tested Reactivity human, mouse, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag34185

Product name: Recombinant human MYB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 485-640 aa of BC064955

Sequence: KMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNFFCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM

Predict reactive species
Full Name v-myb myeloblastosis viral oncogene homolog (avian)
Calculated Molecular Weight 640 aa, 72 kDa
Observed Molecular Weight40-50 kDa, 72-80 kDa
GenBank Accession NumberBC064955
Gene Symbol c-Myb
Gene ID (NCBI) 4602
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP10242
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The MYB protein is a transcription factor that plays a key role in regulating the proliferation/differentiation of progenitor cells in bone marrow, colonic crypts, and neurogenic niches [PMID:18574464]. It is involved in the regulation of epithelial-to-mesenchymal transition (EMT) and invasion in neuroblastoma, colon carcinoma, and embryonic kidney cells through the upregulation of the transcription repressor Slug [PMID:20622260]. It also a DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3', and plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells. MYB exists some isoforms with MV 85, 75, 72, 68, 63 and 40 kDa.

Loading...
||
New chat Able
正在加载,请稍候...