Tested Applications
| Positive WB detected in | HeLa cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18896-1-AP targets B-Myb in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13525 Product name: Recombinant human MYBL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 401-700 aa of BC007585 Sequence: SGIGTPPSVLKRQRKRRVALSPVTENSTSLSFLDSCNSLTPKSTPVKTLPFSPSQFLNFWNKQDTLELESPSLTSTPVCSQKVVVTTPLHRDKTPLHQKHAAFVTPDQKYSMDNTPHTPTPFKNALEKYGPLKPLPQTPHLEEDLKEVLRSEAGIELIIEDDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMSTLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS Predict reactive species |
| Full Name | v-myb myeloblastosis viral oncogene homolog (avian)-like 2 |
| Calculated Molecular Weight | 79 kDa |
| Observed Molecular Weight | 90 kDa |
| GenBank Accession Number | BC007585 |
| Gene Symbol | B Myb |
| Gene ID (NCBI) | 4605 |
| RRID | AB_10644283 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10244 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MYBL2, also named as BMYB, is a 700 amino acid protein, which is phosphorylated by cyclin A/CDK2 during S-phase. MYBL2 is a transcription factor involved in the regulation of cell survival, proliferation, and differentiation. The calculated molecular weight of MYBL2 is 79 kDa, but modified MYBL2 is about 90 kDa (PMID: 11418655).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for B-Myb antibody 18896-1-AP | Download protocol |
| IP protocol for B-Myb antibody 18896-1-AP | Download protocol |
| WB protocol for B-Myb antibody 18896-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-MYBL2 antibody (catalog #18896-1-AP) has 31 citations. They appear in journals including Cancer Research, Cell Reports Medicine, EMBO Molecular Medicine, Cell Death & Disease, Cancer Letters, Journal of Virology, Molecular Therapy Oncology, and BMC Cancer, among others. Research fields are dominated by oncology and cancer biology—covering hepatocellular, lung, ovarian, glioma, breast, gastric, thyroid, and colon cancers—along with cell-cycle regulation, transcription, metabolism, and immunosuppressive microenvironments. Applications are primarily WB, IHC, ChIP, and IP.
| Species | Application | Title |
|---|---|---|
Cancer Res Adaptive Regulation of dNTP Homeostasis Confers Osimertinib Resistance in EGFR-Mutant Non-small Cell Lung Carcinoma. | ||
J Adv Res Omics insights into MYBL2-promoted cancer stem-like cells driving ferroptosis resistance in hepatocellular carcinoma.
| ||
Cell Rep Med Distinctive multicellular immunosuppressive hubs confer different intervention strategies for left- and right-sided colon cancers | ||
Cell Death Dis WEE1 inhibitor exerts synergistic effect with KRAS G12C inhibitor via MYBL2-RRM2 axis in KRASG12C-mutant lung cancer | ||
Cancer Lett Up-regulation of RAN by MYBL2 maintains osteosarcoma cancer stem-like cells population during heterogeneous tumor generation | ||
Cell Death Discov MYBL2 impedes cisplatin sensitivity through suppressing GSDME-mediated pyroptosis in lung adenocarcinoma.
|
Reviews
What customers say
Both reviewers rated this antibody 5 stars for Western Blot. One user reported excellent performance at a 1:1000 dilution, describing it as "very well" and "helpful." The other tested it on human cancer cell lines at 1:100 and noted it performed well even at higher dilutions. Overall, users find this antibody reliable and effective for WB applications across a range of dilutions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mounika (Verified Customer) (09-03-2026) | works very well, helpful.
|
ARUNASALAM (Verified Customer) (07-23-2025) | This antibody works very well in western blotting even with higher dilutions.
|
