L-Myc Polyclonal antibody

• 

  WB analysis using 14584-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14584-1-AP (L-Myc antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

L-Myc Polyclonal Antibody for WB, ELISA

Cat No. 14584-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

bHLHe38, LMYC, L-Myc, MYCL, MYCL1, Protein L Myc 1

---

Tested Applications

• Positive WB detected in: NCI-H1299 cells, U266 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

14584-1-AP targets L-Myc in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6105

  Product name: Recombinant human MYCL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-206 aa of BC011864

  Sequence: MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGPSPPLFG

• Full Name: v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian)
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC011864
• Gene Symbol: MYCL1
• Gene ID (NCBI): 4610
• RRID: AB_3669190
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12524
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The MYC gene family consists of 3 members, C-MYC, L-MYC, and N-MYC, all of which belong to the superfamily of basic helix-loop-helix leucine zipper (bHLHLZ) DNA binding proteins. L-MYC encodes a nuclear phosphoprotein with 364 amino acids, heterodimerizing with partner protein Max and acts as a transcription factor to control the expression of target genes. L-Myc is involved in many biological processes, including cell proliferation, differentiation, apoptosis and has been found to be amplified and over-expressed in some malignancies. L-Myc amplification has been reported in small-cell lung cancer (PMID: 25528583, 33524794). The observed molecular weight of L-Myc is 68 kDa, which is consistent with the description in the literature (PMID: 8657155).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; Merkel cell polyomavirus activates LSD1-mediated blockade of non-canonical BAF to regulate transformation and tumorigenesis.; Authors - Donglim Esther Park

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Sarah (Verified Customer) (10-27-2023)

Antibody worked well for western blot

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000