MYCT1 Polyclonal antibody

• 

  WB analysis of mouse brain using 22004-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22004-1-AP (MYCT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

MYCT1 Polyclonal Antibody for WB, ELISA

Cat No. 22004-1-AP

Publications(4)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

MTLC, MTMC1, myc target 1, Myc target protein 1, MYCT1

---

Tested Applications

• Positive WB detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

22004-1-AP targets MYCT1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4800

  Product name: Recombinant human MYCT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-220 aa of BC022556

  Sequence: LAVLQRDRIKLLFFDILVFLSVFLLFLLFLVDIMANNTTSLGSPWPENFWEDLIMSFTVSMAIGLVLGGFIWAVFICLSRRRRASAPISQWSSSRRSRSSYTHGLNRTGFYGHSGCERRSNLSLASLTFQRQASLEQANSFPRKSSFRASTFHPFLQCPPLPVETESQLVTLPSSNISPTISTSHSLSRPDYWSSNSLRVGLSTPPPPAYESIIKAFPDS

• Full Name: myc target 1
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC022556
• Gene Symbol: MYCT1
• Gene ID (NCBI): 80177
• RRID: AB_2878968
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8N699
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Extracell Vesicles; Optimized AF4 combined with density cushion ultracentrifugation enables profiling of high-purity human blood extracellular vesicles; Authors - Liqiao Hu
human	WB	Front Pharmacol; Overexpression of MYCT1 Inhibits Proliferation and Induces Apoptosis in Human Acute Myeloid Leukemia HL-60 and KG-1a Cells in vitro and in vivo.; Authors - Shuang Fu
human,mouse	WB,IHC,IF	iScience; MYCT1 attenuates renal fibrosis and tubular injury in diabetic kidney disease; Authors - Xin Li
human	WB	J Cancer; MUC15 is an independent prognostic factor that promotes metastases of MYCN non-amplified neuroblastoma; Authors - Huiqin Guo

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Zinnia (Verified Customer) (07-10-2024)

No specific band was detected for endogenous MYCT1 after using siRNA to knockdown Myct1 (more than 90% knockdown efficiency at RNA level)

• Applications: Western Blot
• Cell Tissue Type: Human retinal endos