MYD88 Recombinant monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MYD88 Recombinant monoclonal antibody, PBS Only (Detector) (87040-3-PBS)

MYD88 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 87040-3-PBS

Clone No.252132E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

• 

  Sandwich ELISA sample test of MP03184-1

  The mean MYD88 concentration was determined to be 907.15 ng/mL in Jurkat cell extract based on a 1.20 mg/mL extract load, 2,599.63 ng/mL in Raji cell extract based on a 1.20 mg/mL extract load and 123.62 ng/mL in HCT 116 cell extract based on a 1.30 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP03184-1

  Sandwich ELISA standard curve of MP03184-1, Human MYD88 Recombinant Matched Antibody Pair - PBS only. 87040-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag19770. 87040-3-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87040-3-PBS targets MYD88 as part of a matched antibody pair:

MP03184-1: 87040-4-PBS capture and 87040-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19770

  Product name: Recombinant human MYD88 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC013589

  Sequence: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL

• Full Name: myeloid differentiation primary response gene (88)
• Calculated Molecular Weight: 33 kDa
• GenBank Accession Number: BC013589
• Gene Symbol: MYD88
• Gene ID (NCBI): 4615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99836
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.