MYEF2 Polyclonal antibody

• 

  WB analysis using 16051-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16051-1-AP (MYEF2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 16051-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16051-1-AP (MYEF2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 16051-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16051-1-AP (MYEF2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 16051-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16051-1-AP (MYEF2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 16051-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16051-1-AP (MYEF2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 16051-1-AP

  IP result of anti-MYEF2 (IP:16051-1-AP, 4ug; Detection:16051-1-AP 1:2000) with Jurkat cells lysate 2800ug.

• 

  IHC staining of human breast cancer using 16051-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16051-1-AP (MYEF2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 16051-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16051-1-AP (MYEF2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 16051-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MYEF2 antibody (16051-1-AP) at dilution of 1:500 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

• 

  FC experiment of C6 using 16051-1-AP

  1x10^6 C6 cells were intracellularly stained with 0.25 ug MYEF2 Polyclonal antibody (16051-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

MYEF2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16051-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

HsT18564, KIAA1341, MEF 2, MEF2, MEF-2

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, HepG2 cells, MCF-7 cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 2 publications below
• CoIP: See 1 publications below

Product Information

16051-1-AP targets MYEF2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9010

  Product name: Recombinant human MYEF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-212 aa of BC014533

  Sequence: MDGPGFGGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRGDIGINRGFGDSFGRLGGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRNA

• Full Name: myelin expression factor 2
• Calculated Molecular Weight: 600 aa, 64 kDa
• Observed Molecular Weight: 61-64 kDa
• GenBank Accession Number: BC014533
• Gene Symbol: MYEF2
• Gene ID (NCBI): 50804
• RRID: AB_2146869
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2K5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC,CoIP	Cell Rep; PARP1-mediated PARylation activity is essential for oligodendroglial differentiation and CNS myelination.; Authors - Yan Wang
human	WB,IHC	BMC Gastroenterol; Expression and function of myelin expression factor 2 in hepatocellular carcinoma; Authors - Peng Zhang ; KD Validated
		Aging (Albany NY); MYEF2: an immune infiltration-related prognostic factor in IDH-wild-type glioblastoma; Authors - Yunxiao Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Wael (Verified Customer) (05-16-2023)

Hek293 cells were fractionated into nuclear and cytoplasmic fractions. specific band for MYEF2 between 55 and 100kd, enriched in the Nuclear fraction. Lanes order: 1-ladder 2-Nuclear fraction 3-Cytoplasmic frcation

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Hek293

MYEF2 Antibody Western Blot validation (1:1000 dilution) in Hek293 (Cat no:16051-1-AP)