MYEOV Polyclonal antibody

MYEOV Polyclonal Antibody for WB, IHC, ELISA
Cat No. 11151-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

MYEOV, OCIM, Oncogene in multiple myeloma

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSGC-7901 cells, Jurkat cells
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11151-1-AP targets MYEOV in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1498

Product name: Recombinant human MYEOV protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-313 aa of BC011815

Sequence: MALRICVTYTPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMFTRQAGHFVEGSKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAGLSQEAEDVDVSRARRVTDAPQGTLCGTGNRNSGSQSARAVGVAHLGEAFRVGVEQAISSCPEEVHGRHGLSMEIMWARMDVALRSPGRGLLAGAGALCVTLAESSCPDYERGRRACLTLHRHPTPHCSTWGLPLRVAGSWLTVVTVEALGGWRMGVRRTGQVGPTMHPPPVSGASPLLLHHLLLLLLIIILTC

Predict reactive species
Full Name myeloma overexpressed (in a subset of t(11;14) positive multiple myelomas)
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC011815
Gene Symbol MYEOV
Gene ID (NCBI) 26579
RRIDAB_671520
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96EZ4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYEOV, also named as OCIM, was originally isolated by the application of the NIH/3T3 tumorigenicity assay with DNA from a gastric carcinoma. It is a prognostic factor for patients with multiple myeloma, in part through a role of MYEOV in the control of MMC proliferation. MYEOV is a candidate oncogene activated in the amplification core located proximal toCCND1. The observed MW of this protein is 55 kDa(PMID: 20854874 ).

Protocols

Product Specific Protocols
IHC protocol for MYEOV antibody 11151-1-APDownload protocol
WB protocol for MYEOV antibody 11151-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Cell Oncol (Dordr)

Genomic analysis and filtration of novel prognostic biomarkers based on metabolic and immune subtypes in pancreatic cancer

Authors - Guangyu Chen
humanIHC

Cell Cycle

Overexpression of MYEOV predicting poor prognosis in patients with pancreatic ductal adenocarcinoma.

Authors - Rui Tang
humanWB

Exp Hematol

MYEOV is a prognostic factor in multiple myeloma.

Authors - Moreaux Jerome J
humanWB

Cancers (Basel)

Identification of MYEOV-Associated Gene Network as a Potential Therapeutic Target in Pancreatic Cancer

Authors - Yu Chen
Loading...
||
New chat Able
正在加载,请稍候...