MYEOV Polyclonal antibody

• 

  WB analysis of SGC-7901 using 11151-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 11151-1-AP (MYEOV antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 11151-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11151-1-AP (MYEOV Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 11151-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11151-1-AP (MYEOV antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MYEOV Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11151-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

MYEOV, OCIM, Oncogene in multiple myeloma

---

Tested Applications

• Positive WB detected in: SGC-7901 cells, Jurkat cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 2 publications below

Product Information

11151-1-AP targets MYEOV in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1498

  Product name: Recombinant human MYEOV protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-313 aa of BC011815

  Sequence: MALRICVTYTPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMFTRQAGHFVEGSKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAGLSQEAEDVDVSRARRVTDAPQGTLCGTGNRNSGSQSARAVGVAHLGEAFRVGVEQAISSCPEEVHGRHGLSMEIMWARMDVALRSPGRGLLAGAGALCVTLAESSCPDYERGRRACLTLHRHPTPHCSTWGLPLRVAGSWLTVVTVEALGGWRMGVRRTGQVGPTMHPPPVSGASPLLLHHLLLLLLIIILTC

• Full Name: myeloma overexpressed (in a subset of t(11;14) positive multiple myelomas)
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC011815
• Gene Symbol: MYEOV
• Gene ID (NCBI): 26579
• RRID: AB_671520
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96EZ4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYEOV, also named as OCIM, was originally isolated by the application of the NIH/3T3 tumorigenicity assay with DNA from a gastric carcinoma. It is a prognostic factor for patients with multiple myeloma, in part through a role of MYEOV in the control of MMC proliferation. MYEOV is a candidate oncogene activated in the amplification core located proximal toCCND1. The observed MW of this protein is 55 kDa(PMID: 20854874 ).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Cell Oncol (Dordr); Genomic analysis and filtration of novel prognostic biomarkers based on metabolic and immune subtypes in pancreatic cancer; Authors - Guangyu Chen
human	IHC	Cell Cycle; Overexpression of MYEOV predicting poor prognosis in patients with pancreatic ductal adenocarcinoma.; Authors - Rui Tang
human	WB	Exp Hematol; MYEOV is a prognostic factor in multiple myeloma.; Authors - Moreaux Jerome J
human	WB	Cancers (Basel); Identification of MYEOV-Associated Gene Network as a Potential Therapeutic Target in Pancreatic Cancer; Authors - Yu Chen