MYEOV2 Polyclonal antibody

• 

  WB analysis of MCF-7 using 26151-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26151-1-AP (MYEOV2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

MYEOV2 Polyclonal Antibody for WB, ELISA

Cat No. 26151-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

myeloma overexpressed 2, MYEOV2

---

Tested Applications

• Positive WB detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26151-1-AP targets MYEOV2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23560

  Product name: Recombinant human MYEOV2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-57 aa of BC033955

  Sequence: MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ

• Full Name: myeloma overexpressed 2
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC033955
• Gene Symbol: MYEOV2
• Gene ID (NCBI): 150678
• RRID: AB_2880405
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXC6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYEOV2, also known as Myeloma-overexpressed gene 2 protein, is a low abundance protein. The function of MYEOV2 remains largely unknown. MYEOV2 has 2 isoforms with MW 27 kDa and 6 kDa according to UniProt. Catalog#26151-1-AP specially recognises the 27 kDa isoform.