MYF6 Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 11754-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11754-1-AP (MYF6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skeletal muscle using 11754-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 11754-1-AP (MYF6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 11754-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 11754-1-AP (MYF6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of C2C12 using 11754-1-AP

  Immunofluorescent analysis of (4% PFA) fixed C2C12 cells using MYF6 antibody (11754-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

MYF6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11754-1-AP

Publications(5)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, chip, ELISA

Synonyms

Myf-6, Myf 6, Muscle-specific regulatory factor 4, MRF4, Class C basic helix-loop-helix protein 4

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue
• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: C2C12 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• ChIP: See 1 publications below

Product Information

11754-1-AP targets MYF6 in WB, IHC, IF/ICC, chip, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2350

  Product name: Recombinant human MYF6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-242 aa of BC017834

  Sequence: MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVVEK

• Full Name: myogenic factor 6 (herculin)
• Calculated Molecular Weight: 242 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC017834
• Gene Symbol: MYF6
• Gene ID (NCBI): 4618
• RRID: AB_2250929
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23409
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	chip	Nat Commun; MRF4 negatively regulates adult skeletal muscle growth by repressing MEF2 activity.; Authors - Irene Moretti
human	WB	Front Cell Dev Biol; A Functional SNP in the Promoter of LBX1 Is Associated With the Development of Adolescent Idiopathic Scoliosis Through Involvement in the Myogenesis of Paraspinal Muscles.; Authors - Leilei Xu
	WB	In Vitro Cell Dev Biol Anim; Expression patterns and correlation analyses of muscle-specific genes in the process of sheep myoblast differentiation; Authors - Hejie Wang
mouse	WB	Heliyon; Exogenous hydrogen sulfide enhances myogenic differentiation of C2C12 myoblasts under high palmitate stress; Authors - Fangping Lu
human	WB	Stem Cells Int; Noggin Combined With Human Dental Pulp Stem Cells to Promote Skeletal Muscle Regeneration; Authors - Meng-Han Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Kenzo (Verified Customer) (11-11-2023)

Worked well for frozen mouse heart tissue sections.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: Heart