MYF6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MYF6 Polyclonal antibody (11754-1-AP)

MYF6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11754-1-AP

Publications(8)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, chip, ELISA

Synonyms

Myf-6, Myf 6, Muscle-specific regulatory factor 4, MRF4, Class C basic helix-loop-helix protein 4

• 

  WB analysis of mouse skeletal muscle using 11754-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11754-1-AP (MYF6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 11754-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 11754-1-AP (MYF6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 11754-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 11754-1-AP (MYF6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of C2C12 using 11754-1-AP

  Immunofluorescent analysis of (4% PFA) fixed C2C12 cells using MYF6 antibody (11754-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue
• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: C2C12 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11754-1-AP targets MYF6 in WB, IHC, IF/ICC, chip, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, chicken, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2350

  Product name: Recombinant human MYF6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-242 aa of BC017834

  Sequence: MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVVEK

• Full Name: myogenic factor 6 (herculin)
• Calculated Molecular Weight: 242 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC017834
• Gene Symbol: MYF6
• Gene ID (NCBI): 4618
• RRID: AB_2250929
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23409
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	chip	Nat Commun; MRF4 negatively regulates adult skeletal muscle growth by repressing MEF2 activity.; Authors - Irene Moretti
human	WB	Front Cell Dev Biol; A Functional SNP in the Promoter of LBX1 Is Associated With the Development of Adolescent Idiopathic Scoliosis Through Involvement in the Myogenesis of Paraspinal Muscles.; Authors - Leilei Xu
	WB	In Vitro Cell Dev Biol Anim; Expression patterns and correlation analyses of muscle-specific genes in the process of sheep myoblast differentiation; Authors - Hejie Wang
mouse	WB	Nutrients; Activation of Sirtuin3 by 6,4'-Dihydroxy-7-methoxyflavanone Against Myoblasts Senescence by Attenuating D-Galactose-Induced Oxidative Stress and Inflammation.; Authors - Bingsi Li
human	WB	Stem Cells Int; Noggin Combined With Human Dental Pulp Stem Cells to Promote Skeletal Muscle Regeneration; Authors - Meng-Han Zhang
mouse	WB	Heliyon; Exogenous hydrogen sulfide enhances myogenic differentiation of C2C12 myoblasts under high palmitate stress; Authors - Fangping Lu

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Kenzo (Verified Customer) (11-11-2023)

Worked well for frozen mouse heart tissue sections.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: Heart