MYH10 Monoclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 67243-1-Ig (same clone as 67243-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67243-1-Ig (MYH10 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67243-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67243-1-Ig (same clone as 67243-1-PBS)

  WB result of MYH10 antibody (67243-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MYH10 transfected HEK-293 cells. This data was developed using the same antibody clone with 67243-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse cerebellum using 67243-1-Ig (same clone as 67243-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 67243-1-Ig (MYH10 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67243-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67243-1-Ig (same clone as 67243-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67243-1-Ig (MYH10 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67243-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat cerebellum using 67243-1-Ig (same clone as 67243-1-PBS)

  rat cerebellum tissue were subjected to SDS PAGE followed by western blot with 67243-1-Ig (MYH10 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67243-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 67243-1-Ig (same clone as 67243-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67243-1-Ig (MYH10 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67243-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 67243-1-Ig (same clone as 67243-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67243-1-Ig (MYH10 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67243-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 67243-1-Ig (same clone as 67243-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using MYH10 antibody (67243-1-Ig, Clone: 2H8G7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67243-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MYH10 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67243-1-PBS

Clone No.2H8G7

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

MYH10, Myosin 10, Myosin heavy chain 10

---

Product Information

67243-1-PBS targets MYH10 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17069

  Product name: Recombinant human MYH10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1183-1322 aa of BC150634

  Sequence: QEVAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAASL

• Full Name: myosin, heavy chain 10, non-muscle
• Calculated Molecular Weight: 1985 aa, 230 kDa
• Observed Molecular Weight: 200-230 kDa
• GenBank Accession Number: BC150634
• Gene Symbol: MYH10
• Gene ID (NCBI): 4628
• RRID: AB_2882522
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35580
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYH10 (non-muscle II-b, NM IIB) is a member of non-muscle myosin II which plays fundamental roles in the maintenance of cell morphology, cell adhesion, and migration, as well as cell division. MYH10 is mainly present in nerve cells, megakaryocytes, and other non-muscle cells. It has been reported to mediate centrosome reorientation during cell migration and contribute to ciliogenesis. Overexpression of MYH10 has been observed in breast cancer.