SMMHC Polyclonal antibody

• 

  WB analysis of mouse colon using 18569-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 18569-1-AP (SMMHC antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse uterus using 18569-1-AP

  mouse uterus tissue were subjected to SDS PAGE followed by western blot with 18569-1-AP (SMMHC antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse bladder using 18569-1-AP

  mouse bladder tissue were subjected to SDS PAGE followed by western blot with 18569-1-AP (SMMHC antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat uterus using 18569-1-AP

  rat uterus tissue were subjected to SDS PAGE followed by western blot with 18569-1-AP (SMMHC antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human normal colon using 18569-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 18569-1-AP (SMMHC antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SMMHC Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18569-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

MYH11, Myosin-11, Myosin heavy chain 11, Myosin 11, KIAA0866

---

Tested Applications

• Positive WB detected in: mouse colon tissue, mouse bladder tissue, mouse uterus tissue, rat uterus tissue
• Positive IHC detected in: human normal colon; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

18569-1-AP targets SMMHC in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13391

  Product name: Recombinant human MYH11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC101677

  Sequence: MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVS

• Full Name: myosin, heavy chain 11, smooth muscle
• Calculated Molecular Weight: 1938 aa, 224 kDa
• Observed Molecular Weight: 227 kDa
• GenBank Accession Number: BC101677
• Gene Symbol: SMMHC/MYH11
• Gene ID (NCBI): 4629
• RRID: AB_10644123
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35749
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Am Heart Assoc; LINC01278 Sponges miR-500b-5p to Regulate the Expression of ACTG2 to Control Phenotypic Switching in Human Vascular Smooth Muscle Cells During Aortic Dissection.; Authors - Weitie Wang
rat	WB	Front Pharmacol; Theaflavin-3,3'-Digallate from Black Tea Inhibits Neointima Formation Through Suppression of the PDGFRβ Pathway in Vascular Smooth Muscle Cells.; Authors - Yichen Wu
human	WB	Front Med (Lausanne); Depiction of Aging-Based Molecular Phenotypes With Diverse Clinical Prognosis and Immunological Features in Gastric Cancer.; Authors - Fang He
human	IHC	BMC Cancer; Identification of a mitophagy-related gene signature for predicting overall survival and response to immunotherapy in rectal cancer; Authors - Jian Yang
human	WB	Ultrasound Med Biol; 5-Aminolevulinic Acid-Mediated Sonodynamic Therapy Promotes Phenotypic Switching from Dedifferentiated to Differentiated Phenotype via Reactive Oxygen Species and p38 Mitogen-Activated Protein Kinase in Vascular Smooth Muscle Cells.; Authors - Juhua Dan
mouse	IHC	Cell Signal; Sphingosine 1-phosphate receptor 2 promotes erythrocyte clearance by vascular smooth muscle cells in intraplaque hemorrhage through MFG-E8 production.; Authors - Daorong Pan