MYL1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MYL1 Polyclonal antibody (15814-1-AP)

MYL1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15814-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

MLC1/MLC3, MLC1F, MLC1F/MLC3F, MLC3F, MYL1, Myosin light chain A1/A2, Myosin light chain alkali 1/2

• 

  WB analysis of human skeletal muscle using 15814-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15814-1-AP (MYL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 15814-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15814-1-AP (MYL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 15814-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15814-1-AP (MYL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 15814-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 15814-1-AP (MYL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skin using 15814-1-AP

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 15814-1-AP (MYL1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat skeletal muscle using 15814-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 15814-1-AP (MYL1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat skeletal muscle using 15814-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 15814-1-AP (MYL1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 15814-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 15814-1-AP (MYL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat skeletal muscle using 15814-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 15814-1-AP (MYL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MYL1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human skeletal muscle tissue, human heart tissue, mouse heart tissue, mouse skeletal muscle tissue, mouse skin tissue
• Positive IHC detected in: rat skeletal muscle tissue, mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15814-1-AP targets MYL1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8594

  Product name: Recombinant human MYL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC005318

  Sequence: MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI

• Full Name: myosin, light chain 1, alkali; skeletal, fast
• Calculated Molecular Weight: 150aa,17 kDa; 194aa,22 kDa
• Observed Molecular Weight: 14-17 kDa, 22-25 kDa
• GenBank Accession Number: BC005318
• Gene Symbol: MYL1
• Gene ID (NCBI): 4632
• RRID: AB_2266747
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05976
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MYL1 Polyclonal antibody (Cat# 15814-1-AP) has 6 citations published in Nature, J Cachexia Sarcopenia Muscle, Cell Proliferation, J Inflammation Research, Sexual Medicine, and bioRxiv. Research fields span mTORC1 signaling and amino acid sensing, heart failure with preserved ejection fraction, pluripotent stem cell transcriptional regulation, rheumatoid arthritis biomarker discovery, diet-induced erectile dysfunction and metabolic homeostasis, and cerebellar neural development.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nature; SAR1B senses leucine levels to regulate mTORC1 signalling.; Authors - Jie Chen
		J Cachexia Sarcopenia Muscle; MyoMed205 Counteracts Titin Hyperphosphorylation and the Expression of Contraction-Regulating Proteins in a Rat Model of HFpEF; Authors - Beatrice Vahle
mouse	WB	Cell Prolif; KLF3 promotes the 8-cell-like transcriptional state in pluripotent stem cells.; Authors - Jing Hao
rat	WB	J Inflamm Res; Downregulated MYL1 Emerges as a Promising Diagnostic Biomarker for Rheumatoid Arthritis.; Authors - Chaoquan Yang
		Sex Med; Bakh formula ameliorates high-fat diet-induced erectile dysfunction in rats via coordinated restoration of metabolic and tissue homeostasis.; Authors - Jinyuan Zhu
mouse	IF	bioRxiv; Active repression of muscle fate preserves neural lineage identity during cerebellum development.; Authors - Nurunnabi Mirja Shaikh