MYL1 Polyclonal antibody

• 

  WB analysis of human skeletal muscle using 15814-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15814-1-AP (MYL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 15814-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15814-1-AP (MYL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 15814-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15814-1-AP (MYL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 15814-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 15814-1-AP (MYL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skin using 15814-1-AP

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 15814-1-AP (MYL1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat skeletal muscle using 15814-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 15814-1-AP (MYL1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skeletal muscle using 15814-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 15814-1-AP (MYL1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 15814-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 15814-1-AP (MYL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skeletal muscle using 15814-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 15814-1-AP (MYL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MYL1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15814-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

MLC1/MLC3, MLC1F, MLC1F/MLC3F, MLC3F, MYL1, Myosin light chain A1/A2, Myosin light chain alkali 1/2

---

Tested Applications

• Positive WB detected in: human skeletal muscle tissue, human heart tissue, mouse heart tissue, mouse skeletal muscle tissue, mouse skin tissue
• Positive IHC detected in: rat skeletal muscle tissue, mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

15814-1-AP targets MYL1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8594

  Product name: Recombinant human MYL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC005318

  Sequence: MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI

• Full Name: myosin, light chain 1, alkali; skeletal, fast
• Calculated Molecular Weight: 150aa,17 kDa; 194aa,22 kDa
• Observed Molecular Weight: 14-17 kDa, 22-25 kDa
• GenBank Accession Number: BC005318
• Gene Symbol: MYL1
• Gene ID (NCBI): 4632
• RRID: AB_2266747
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05976
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nature; SAR1B senses leucine levels to regulate mTORC1 signalling.; Authors - Jie Chen
mouse	WB	Cell Prolif; KLF3 promotes the 8-cell-like transcriptional state in pluripotent stem cells.; Authors - Jing Hao