MYL10 Polyclonal antibody

• 

  WB analysis using 15396-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15396-1-AP (MYL10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

MYL10 Polyclonal Antibody for WB, ELISA

Cat No. 15396-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

MYLC2PL, Myosin light chain 2, lymphocyte-specific, PLRLC, Precursor lymphocyte-specific regulatory light chain

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15396-1-AP targets MYL10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7594

  Product name: Recombinant human MYL10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-226 aa of BC002778

  Sequence: MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD

• Full Name: myosin, light chain 10, regulatory
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC002778
• Gene Symbol: MYL10
• Gene ID (NCBI): 93408
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUA6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

In non-muscle cells, MLCs are either regulatory (RLC) or essential ELCs. The human RLC gene family encompasses MYL2, MYL5, MYL9, MYL10, MYL11, MYL12A, and MYL12B , with the ELC gene family including MYL1 , MYL3, MYL4, and MYL6(PMID: 39768172). MYL10, also known as PLRLC, encodes for an RLC that might be a lymphocyte specific precursor. MYL10 is a regulatory myosin light chain that is expressed in pre-B cells from adult bone marrow, but not those from fetal liver, upon exposure to IL-7(PMID: 1628631).