MYL5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MYL5 Polyclonal antibody (14249-1-AP)

• Featured Product
• KD/KO Validated

MYL5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14249-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

Synonyms

MYL5, MyLC 2, MYLC2, Myosin light chain 5

• 

  WB analysis using 14249-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14249-1-AP (MYL5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 14249-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14249-1-AP (MYL5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 14249-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 14249-1-AP (MYL5 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 14249-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 14249-1-AP (MYL5 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 14249-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 14249-1-AP (MYL5 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 14249-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 14249-1-AP (MYL5 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 14249-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 14249-1-AP (MYL5 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 14249-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 14249-1-AP (MYL5 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MYL5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, human brain tissue, rat skeletal muscle tissue
• Positive IHC detected in: human cervical cancer tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14249-1-AP targets MYL5 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5522

  Product name: Recombinant human MYL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-132 aa of BC040050

  Sequence: MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE

• Full Name: myosin, light chain 5, regulatory
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC040050
• Gene Symbol: MYL5
• Gene ID (NCBI): 4636
• RRID: AB_2266762
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02045
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MYL5 Polyclonal antibody (Cat# 14249-1-AP) has 1 citation. It was cited in Cytoskeleton (Hoboken) in a 2021 study investigating the localization of myosin regulatory light chain Myl5 to mitotic spindle poles and its role in proper cell division. The associated research field is cytoskeleton biology and cell division.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB, IF	Cytoskeleton (Hoboken); The myosin regulatory light chain Myl5 localizes to mitotic spindle poles and is required for proper cell division.; Authors - Ivan Ramirez ; KD Validated