MYL6 Polyclonal antibody

• 

  WB analysis using 18158-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18158-1-AP (MYL6 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 18158-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 18158-1-AP (MYL6 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 18158-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using MYL6 antibody (18158-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

MYL6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18158-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MYL 6, MLC-3

---

Tested Applications

• Positive WB detected in: mouse uterus tissue, rat uterus tissue
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18158-1-AP targets MYL6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12964

  Product name: Recombinant human MYL6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC006781

  Sequence: MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG

• Full Name: myosin, light chain 6, alkali, smooth muscle and non-muscle
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 15-20 kDa
• GenBank Accession Number: BC006781
• Gene Symbol: MYL6
• Gene ID (NCBI): 4637
• RRID: AB_3085557
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P60660
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. MYL6 (Myosin light polypeptide 6), encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Expression of MYL6 is high in fibroblasts and myoblasts (PMID:8188229, PubMed:2304459, PMID:2722814).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Gaurav (Verified Customer) (11-14-2025)

Good antibody which works also in wide range of experiments.

• Applications: Western Blot, Cell culture
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: Mouse ECs, Rat SMCs, HEK293 cells