MYNN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MYNN Polyclonal antibody, PBS Only (13369-1-PBS)

• 

  WB analysis using 13369-1-AP (same clone as 13369-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13369-1-AP (MYNN antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13369-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 13369-1-AP (same clone as 13369-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13369-1-AP (MYNN Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 13369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 13369-1-AP (same clone as 13369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13369-1-AP (MYNN antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 13369-1-AP (same clone as 13369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13369-1-AP (MYNN antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13369-1-PBS in a different storage buffer formulation.

MYNN Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13369-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

13369-1-PBS targets MYNN in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4188

  Product name: Recombinant human MYNN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 303-610 aa of BC033620

  Sequence: MCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGEKPYKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTGEKPYICGICGKSFISSGELNKHFRSHTGERPFICELCGNSYTDIKNLKKHKTKVHSGADKTLDSSAEDHTLSEQDSIQKSPLSETMDVKPSDMTLPLALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSEPQLIFLQQLY

• Full Name: myoneurin
• Calculated Molecular Weight: 610 aa, 69 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC033620
• Gene Symbol: MYNN
• Gene ID (NCBI): 55892
• RRID: AB_2923559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPC7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Myoneurin (MYNN) gene locates on 3q26.2 and encodes a member of the BTB/POZ and zinc finger (ZF) domain-containing protein family that is involved in the control of gene expression. MYNN is widely expressed in various tissue types in mammals. MYNN has 4 isoforms with the molecular mass of 10, 57, 65-69 kDa. (PMID: 30120764)