MYO10 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MYO10 Polyclonal antibody (24565-1-AP)

• Featured Product
• KD/KO Validated

MYO10 Polyclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 24565-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

KIAA0799, myosin X, Unconventional myosin 10, Unconventional myosin-10, Unconventional myosin-X

• 

  WB analysis using 24565-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24565-1-AP (MYO10 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 24565-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24565-1-AP (MYO10 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 24565-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24565-1-AP (MYO10 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SH-SY5Y using 24565-1-AP

  Immunofluorescent analysis of SH-SY5Y cells using 24565-1-AP (MYO10 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of RAW 264.7 using 24565-1-AP

  1X10^6 RAW 264.7 cells were stained with 0.2ug MYO10 antibody (24565-1-AP, red) and control antibody (blue). Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) with dilution 1:1500. Cells were fixed with 4% PFA and permeabilized with 0.1% Triton X-100.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MYO10 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, mouse brain tissue, Neuro-2a cells
• Positive IF/ICC detected in: SH-SY5Y cells
• Positive FC (Intra) detected in: RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24565-1-AP targets MYO10 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18882

  Product name: Recombinant human MYO10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1669-1917 aa of BC137168

  Sequence: ALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFTPCERLEKRRTSFLEGTLRRSFRTGSVVRQKVEEEQMLDMWIKEEV

• Full Name: myosin X
• Calculated Molecular Weight: 2058 aa, 237 kDa
• Observed Molecular Weight: 240-250 kDa
• GenBank Accession Number: BC137168
• Gene Symbol: MYO10
• Gene ID (NCBI): 4651
• RRID: AB_2879611
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HD67
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MYO10 (Myosin X) antibody (Cat# 24565-1-AP) has 5 total citations published in Science Advances, Proteomics Clinical Applications, PLoS One, Cytoskeleton, and eLife. The associated research fields span cancer genomics and inflammation, ureteropelvic junction obstruction, meiotic spindle assembly, mitotic cell division and cytoskeletal regulation, and sensory axon outgrowth in neural development. Applications include immunofluorescence and Western blot across human, mouse, and zebrafish species.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Sci Adv; MYO10 drives genomic instability and inflammation in cancer.; Authors - Franklin Mayca Pozo ; KO Validated
human	WB	Proteomics Clin Appl; Quantitative Proteome of Infant Stenotic Ureters Reveals Extracellular Matrix Organization and Oxidative Stress Dysregulation Underlying Ureteropelvic Junction Obstruction.; Authors - Yueyan Li
mouse	IF	PLoS One; NIMA-related kinase 1 (NEK1) regulates meiosis I spindle assembly by altering the balance between α-Adducin and Myosin X.; Authors - Miguel A Brieño-Enríquez
human	WB	Cytoskeleton (Hoboken); The myosin regulatory light chain Myl5 localizes to mitotic spindle poles and is required for proper cell division.; Authors - Ivan Ramirez
zebrafish		Elife; Retrograde Ret signaling controls sensory pioneer axon outgrowth.; Authors - Adam Tuttle