MYO10 Polyclonal antibody

• 

  WB analysis of mouse brain using 24565-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24565-1-AP (MYO10 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 24565-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24565-1-AP (MYO10 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of SH-SY5Y using 24565-1-AP

  Immunofluorescent analysis of SH-SY5Y cells using 24565-1-AP (MYO10 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of RAW 264.7 using 24565-1-AP

  1X10^6 RAW 264.7 cells were stained with 0.2ug MYO10 antibody (24565-1-AP, red) and control antibody (blue). Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) with dilution 1:1500. Cells were fixed with 4% PFA and permeabilized with 0.1% Triton X-100.

• Featured Product
• KD/KO Validated

MYO10 Polyclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 24565-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

KIAA0799, myosin X, Unconventional myosin 10, Unconventional myosin-10, Unconventional myosin-X

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HeLa cells
• Positive IF/ICC detected in: SH-SY5Y cells
• Positive FC (Intra) detected in: RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

24565-1-AP targets MYO10 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18882

  Product name: Recombinant human MYO10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1669-1917 aa of BC137168

  Sequence: ALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFTPCERLEKRRTSFLEGTLRRSFRTGSVVRQKVEEEQMLDMWIKEEV

• Full Name: myosin X
• Calculated Molecular Weight: 2058 aa, 237 kDa
• Observed Molecular Weight: 240-250 kDa
• GenBank Accession Number: BC137168
• Gene Symbol: MYO10
• Gene ID (NCBI): 4651
• RRID: AB_2879611
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HD67
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Sci Adv; MYO10 drives genomic instability and inflammation in cancer.; Authors - Franklin Mayca Pozo ; KO Validated
zebrafish	IHC	Elife; Retrograde Ret signaling controls sensory pioneer axon outgrowth.; Authors - Adam Tuttle
mouse	IF	PLoS One; NIMA-related kinase 1 (NEK1) regulates meiosis I spindle assembly by altering the balance between α-Adducin and Myosin X.; Authors - Miguel A Brieño-Enríquez
human	WB	Proteomics Clin Appl; Quantitative Proteome of Infant Stenotic Ureters Reveals Extracellular Matrix Organization and Oxidative Stress Dysregulation Underlying Ureteropelvic Junction Obstruction.; Authors - Yueyan Li
human	WB	Cytoskeleton (Hoboken); The myosin regulatory light chain Myl5 localizes to mitotic spindle poles and is required for proper cell division.; Authors - Ivan Ramirez