MYO1B Polyclonal antibody

• 

  IHC staining of human heart using 15012-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 15012-1-AP (MYO1B antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 15012-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 15012-1-AP (MYO1B antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse brain using 15012-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15012-1-AP (MYO1B Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of mouse brain using 15012-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15012-1-AP (MYO1B Antibody) at dilution of 1:50 (under 40x lens).

MYO1B Polyclonal Antibody for IHC, ELISA

Cat No. 15012-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

MMI alpha, MMIa, MYH 1c, MYO1B, Myosin I alpha, myosin IB, myr1

---

Tested Applications

• Positive IHC detected in: human heart tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

15012-1-AP targets MYO1B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6895

  Product name: Recombinant human MYO1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 786-1136 aa of BC053558

  Sequence: IAAYWHGTQARRELRRLKEEARNKHAIAVIWAYWLGSKARRELKRLKEEARRKHAVAVIWAYWLGLKVRREYRKFFRANAGKKIYEFTLQRIVQKYFLEMKNKMPSLSPIDKNWPSRPYLFLDSTHKELKRIFHLWRCKKYRDQFTDQQKLIYEEKLEASELFKDKKALYPSSVGQPFQGAYLEINKNPKYKKLKDAIEEKIIIAEVVNKINRANGKSTSRIFLLTNNNLLLADQKSGQIKSEVPLVDVTKVSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSVPTCKRKNNRLLEVAVP

• Full Name: myosin IB
• Calculated Molecular Weight: 132 kDa, 125 kDa
• GenBank Accession Number: BC053558
• Gene Symbol: MYO1B
• Gene ID (NCBI): 4430
• RRID: AB_10642004
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43795
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Res; A Genome-Wide Synthetic Lethal Screen Identifies Spermidine Synthase as a Target to Enhance Erdafitinib Efficacy in FGFR-Mutant Bladder Cancer; Authors - Yanchao Yu
human	WB	Front Pharmacol; Cyperotundone promotes chemosensitivity of breast cancer via SRSF1; Authors - Chao Li