MYO1E Polyclonal antibody

• 

  WB analysis using 17768-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17768-1-AP (MYO1E antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 17768-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17768-1-AP (MYO1E antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 17768-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17768-1-AP (MYO1E antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 17768-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 17768-1-AP (MYO1E antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

MYO1E Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17768-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

HuncM IC, MYO1E, Myosin Ic, myosin IE

---

Tested Applications

• Positive WB detected in: HT-1080 cells, HeLa cells, Jurkat cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 4 publications below
• IF: See 1 publications below

Product Information

17768-1-AP targets MYO1E in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12176

  Product name: Recombinant human MYO1E protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC098392

  Sequence: MGSKGVYQYHWQSHNVKHSGVDDMVLLSKITENSIVENLKKRYMDDYIFTYIGSVLISVNPFKQMPYFGEKEIEMYQGAAQYENPPHIYALADNMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSYISRVSGGGTKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASAEQKHSLGITSMDYYYYLSLSGSYKVDDIDDRREFQETLHAMNVIGIFAEEQTLVLQIVAGILHLGNISFKEVGNYAAVESEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACY

• Full Name: myosin IE
• Calculated Molecular Weight: 1108 aa, 127 kDa
• Observed Molecular Weight: 127 kDa
• GenBank Accession Number: BC098392
• Gene Symbol: MYO1E
• Gene ID (NCBI): 4643
• RRID: AB_2251045
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12965
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYO1E, also named as Myosin-Ie and MYO1C (distinct from the MYO1C gene located on chromosome 17), encodes a member of the nonmuscle class I myosins which are a subgroup of the unconventional myosin protein family. The unconventional myosin proteins function as actin-based molecular motors. This protein localizes to the cytoplasm and may be involved in intracellular movement and membrane trafficking. Mutations in this gene are the cause of focal segmental glomerulosclerosis-6.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Front Immunol; Myo1f has an essential role in γδT intraepithelial lymphocyte adhesion and migration; Authors - Irving Ulises Martínez-Vargas
mouse	WB	Eur J Immunol; The class I myosin Myo1e regulates TLR4-triggered macrophage spreading, chemokine release and antigen presentation via MHC class II.; Authors - Jens Wenzel ; KO Validated
		iScience; Multi-omics approach reveals posttranscriptionally regulated genes are essential for human pluripotent stem cells.; Authors - Mio Iwasaki
human	WB,IF	Oncol Lett; Analysis and validation of the potential of the MYO1E gene in pancreatic adenocarcinoma based on a bioinformatics approach; Authors - Songbai Liu ; KD Validated
mouse	WB	Exp Neurol; Roles of Adam8 in Neuroinflammation in experimental ischemic Stroke: Insights from single-cell and ribosome-bound mRNA sequencing; Authors - Jiale Liu ; KD Validated