MYO1E Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MYO1E Polyclonal antibody (28771-1-AP)

• 

  WB analysis using 28771-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28771-1-AP (MYO1E antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

MYO1E Polyclonal Antibody for WB, ELISA

Cat No. 28771-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

MYO1C, HuncM IC, Myosin Ic, myosin IE, Myosin-Ic

---

Tested Applications

• Positive WB detected in: A549 cells, Calu-1 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28771-1-AP targets MYO1E in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30338

  Product name: Recombinant human MYO1E protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 930-1044 aa of BC098392

  Sequence: PTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQNGVIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPESLDFLKVPDQGAAGVRRQTTSRPPPAGGRPK

• Full Name: myosin IE
• Calculated Molecular Weight: 1108 aa, 127 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC098392
• Gene Symbol: MYO1E
• Gene ID (NCBI): 4643
• RRID: AB_3742300
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12965
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.