MYO1F Polyclonal antibody

• 

  WB analysis using 28841-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28841-1-AP (MYO1F antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of THP-1 using 28841-1-AP

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using MYO1F antibody (28841-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

MYO1F Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 28841-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Unconventional myosin-If, Myosin-Ie, myosin IF, Myosin Ie

---

Tested Applications

• Positive WB detected in: Jurkat cells, rat spleen tissue
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28841-1-AP targets MYO1F in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29899

  Product name: Recombinant human MYO1F protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 198-276 aa of BC028071

  Sequence: VMQNENERNFHIYYQLLEGASQEQRQNLGLMTPDYYYYLNQSDTYQVDGTDDRSDFGETLSAMQVIGIPPSIQQLVLQL

• Full Name: myosin IF
• Calculated Molecular Weight: 1098 aa, 125 kDa
• Observed Molecular Weight: 115-125 kDa
• GenBank Accession Number: BC028071
• Gene Symbol: MYO1F
• Gene ID (NCBI): 4542
• RRID: AB_3669671
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00160
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Myosin family members are proteins that hydrolyze ATP to generate force or directional movement along actin filaments and are implicated in the rearrangement of the cytoskeleton in several cell types. Myosin 1F (MYO1F), a long tailed class I myosin, is highly expressed in natural killer (NK) cells, macrophages, dendritic cells, and neutrophils. MYO1F plays a critical role in the mediating of signaling molecules "trafficking from membrane to cytoplasm," and this process is essential for the antifungal signaling pathway activation.