MYO6 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

• 

  WB analysis using 84085-3-RR (same clone as 84085-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84085-3-RR (MYO6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84085-3-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 84085-3-RR (same clone as 84085-3-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 84085-3-RR (MYO6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84085-3-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP01001-1

  Cytometric bead array standard curve of MP01001-1, MYO6 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84085-3-PBS. Detection antibody: 84085-1-PBS. Standard: Ag24906. Range: 0.781-100 ng/ml.

• 

  Cytometric bead array standard curve of MP01001-3

  Cytometric bead array standard curve of MP01001-3, MYO6 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84085-2-PBS. Detection antibody: 84085-3-PBS. Standard: Ag24906. Range: 0.781-100 ng/ml.

MYO6 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 84085-3-PBS

Clone No.241251G11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

241251G11, DFNA22, DFNB37, KIAA0389, myosin VI

---

Product Information

84085-3-PBS targets MYO6 as part of a matched antibody pair:

MP01001-1: 84085-3-PBS capture and 84085-1-PBS detection (validated in Cytometric bead array)

MP01001-3: 84085-2-PBS capture and 84085-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24906

  Product name: Recombinant human MYO6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-145 aa of BC146764

  Sequence: MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKVLKMSQ

• Full Name: myosin VI
• Calculated Molecular Weight: 1285 aa, 149 kDa
• Observed Molecular Weight: 145-150 kDa
• GenBank Accession Number: BC146764
• Gene Symbol: MYO6
• Gene ID (NCBI): 4646
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UM54
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYO6, an actin-based motor protein, is the only myosin known to move toward the minus end of actin filaments. MYO6 is highly expressed in the inner and outer hair cells of the ear, retina, and polarized epithelial cells such as kidney proximal tubule cells and intestinal enterocytes. And it participates in a wide range of biological processes within cells, including clathrin-mediated endocytosis, vesicular membrane traffic, polarized secretion, and autophagy (PMID: 23620821; PMID: 28591580). Previous studies showed that MYO6 is upregulated in various types of cancer, and it has been widely reported to contribute to tumor cell migration and metastasis. Some articles indicate that MYO6 is associated with prostate cancer, lung cancer, human colorectal cancer and gastric cancer (PMID: 29022908).